PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G035500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 359aa    MW: 38432.9 Da    PI: 6.1769
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G035500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.81.1e-49221501128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k..kvka...eekewyfFskrdkkyatgkrknratksgyWka 85 
                         lppGfrFhPtdeelv++yL++k+ g +l +  vi+evd+yk+ePw+Lp k     a   + kewyfFs+rd+ky++g+r+nra+ +gyWka
  Brast05G035500.1.p  22 LPPGFRFHPTDEELVNYYLCRKCGGLPLAA-PVIAEVDLYKFEPWRLPeKsaG--AggdDAKEWYFFSPRDRKYPNGSRPNRAAGTGYWKA 109
                         79*************************999.89***************44331..2443666***************************** PP

                 NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         tg dk+v s   + v +kk Lvfy g+ pkg+kt+W+mheyrl
  Brast05G035500.1.p 110 TGADKPVGS--PRPVAIKKALVFYAGKPPKGVKTNWIMHEYRL 150
                         *******99..779***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.32E-5916181IPR003441NAC domain
PROSITE profilePS5100558.68422181IPR003441NAC domain
PfamPF023654.9E-2623150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MDYYCGGGSS DQSLSSSPSL SLPPGFRFHP TDEELVNYYL CRKCGGLPLA APVIAEVDLY  60
KFEPWRLPEK SAGAGGDDAK EWYFFSPRDR KYPNGSRPNR AAGTGYWKAT GADKPVGSPR  120
PVAIKKALVF YAGKPPKGVK TNWIMHEYRL ADVDRSAAAR KKNNHNALRL DDWVLCRIYN  180
KKGVIERHDT ADSSVSDSGD VKPAAPPAAK KNPRAAPPAM KVELSDYGFY GGNHPSPPAT  240
EMLCFERGAA ADSMPRLHTD SSSSDRALSS PSQISLSPEF PSDMDYAESQ HIAAATGANA  300
AGGEGGGWLG EDWAGAIDDD GFVMDGGSLV FDPPLSPGAF ARDAAAFGDM LAYLQKPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-721918712174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3572071e-170AK357207.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1048E22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577759.10.0PREDICTED: NAC domain-containing protein 71-like
SwissprotQ53NF71e-145NAC71_ORYSJ; NAC domain-containing protein 71
TrEMBLI1IMW90.0I1IMW9_BRADI; Uncharacterized protein
STRINGBRADI4G23640.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118043039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.11e-89NAC family protein